PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G183300.1
Common NamePHAVU_009G183300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 341aa    MW: 37013.9 Da    PI: 10.1013
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G183300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-14129173347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
  Phvul.009G183300.1 129 PWTEEEHKLFLVGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 173
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.519122178IPR017930Myb domain
SuperFamilySSF466897.18E-17124178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-16125176IPR006447Myb domain, plants
SMARTSM007174.6E-9126176IPR001005SANT/Myb domain
CDDcd001671.71E-9129174No hitNo description
PfamPF002492.8E-11129173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-10129173IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MIPHIKPYFK HFCLLTTPLS LSLVLITSSH IPFTNATIHF SLPTNANRKM PLSSASATPH  60
SASSAEIMLF GVRVVVDSMR KSVSMSNLSQ YDHPRDNAKD DAVAAGYASA DDAAPNNSGK  120
IRDRKRGIPW TEEEHKLFLV GLQKVGKGDW RGISRNYVKT RTPTQVASHA QKYFLRRTNL  180
NRRRRRSSLF DITTDSVSTT PMEEGQIQHQ DNVSLVHPMY PVTPEGSNMN GFSMMPMYSK  240
DIGSGIMSAP AGNPMKILTL GQGNVEQNGP STKLFSTAHI VPDHRGSTAS DITASLSSVD  300
PPTLSLGLSL SSSQRQTSSI HSAFHSLSCF NSGDSVISVA *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00236DAPTransfer from AT1G74840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138137.10.0hypothetical protein PHAVU_009G183300g
SwissprotQ2V9B07e-64MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV7B1060.0V7B106_PHAVU; Uncharacterized protein
STRINGGLYMA04G34720.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.26e-46MYB_related family protein